ULTIMO AGGIORNAMENTO BANCA DATI: 13/09/2024 13:00:57
Migrating fish often want to travel between different bodies of water, which may be positioned at different heights. To overcome these heights, water passages may be used that provide a water path at a slope over which a fish is able to swim up. A compact housing is provided by allowing a water guide ...
The sex of embryos in eggs is influenced or controlled through the application of light having selected wavelengths in order to promote the development of embryos of a selected sex. An incubating device is provided having an interior cavity that can be sealed from an outside, and having a plurality ...
A method of producing zooplankton biomass rich in a target compound, the method comprising the steps of: (a) providing one or more species of microalgae and/or cyanobacteria; (b) optionally stimulating the microalgae and/or cyanobacteria; (c) contacting the microalgae and/or cyanobacteria with one or ...
Standalone and self-contained cooling systems using compressed liquid and/or gas CO2 containers positioned in an insulated or non-insulated vessel and consisting of a specially designed unit where the containers are vertically positioned in an upright or upside-down position. The liquid and/or gas CO2 ...
The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, ...
This invention relates to a flowline system (100) for processing food products (401). A feeding conveyor (101) is provided for conveying the food products to be processed, a plurality of workstations (102) are arranged along the feeding conveyor, a diverting means (105) are associated with each of the ...
A liferaft system comprises a container (10) for storing a liferaft (11), and at least one sheet of material (36, 42, 44) for fitting over an exterior surface of the liferaft container and configured to heat an interior volume of the liferaft container.
An image processing device which generates an image where a target object can be discriminated from an object other than the target object. An image processor (15), for echo signals read from a sweep memory (14), calculates a ratio of echo signals indicating a predetermined level or higher among the ...
A rapid transition floating vessel that is able to follow the yaw motions of a turret moored floating vessel is provided. The rapid transition floating vessel includes a system and processes for dynamically positioning the floating vessel alongside a turret moored floating vessel whereby the floating ...
An insulating protective glove (1) for work under electrical voltage, as a finger of the glove with a glove body (2) and glove fingers (3) is carried out and a front inner hand surface, a rear glove back (4) and at one end a indentations opening (5) for introducing the hand into the finger glove comprises, ...
A grip enhancing device having fingers for enhancing grip by at least one artificial tendon, wherein the at least one artificial tendon is provided along at least one finger, wherein the finger comprises material along both sides and a tip and also along a dorsal side, the at least one artificial tendon ...
There is described a module for an underwater structure. The module comprises a plurality of walls defining a cavity configured such that at least two walls of said plurality of walls confront one another to provide respective stack support surfaces for supporting a said module, said walls are substantially ...
Microorganisms and methods are provided for producing biomass that includes PHB and protein in weight ratios and polymer lengths that are beneficial in feed and nutritional supplement compositions. The compositions also may be used for improvement in feed compositions that improve survivability of livestock ...
The present invention relates to a method for improving performance parameters of an animal comprising administering to the animal a mixture of a mono-tocopheryl phosphate and a di-tocopheryl phosphate, wherein the di-tocopheryl phosphate is in a proportion of at least 10% by weight of the tocopheryl ...
The present disclosure relates to imaging for determination of crustacean physical attributes. An image of a shell of a live crustacean is captured and processed to determine a physical attribute of the live crustacean. In an embodiment a characteristic of a pattern indicative of moult stage of the ...
The invention relates to a device, particularly an extraction device or evaporation device, comprising at least one receiver for a container (4), at least one heating element for said container (4), at least one light source (1), at least one sensor (2), and an evaluation unit. The light source (1) ...
The present disclosure relates to a device for the high-pressure treatment of products, particularly of packaged foodstuffs. The device comprises a high-pressure chamber and a discharge valve for discharging high-pressure medium out of the high-pressure chamber. The invention is characterized in that ...
A slicing machine for slicing meat strands that have a cross section that varies over a longitudinal extension in large numbers and as quickly as possible into weight precise slices. In one embodiment, two meat strands are received adjacent to each other in a respective form tube and pushed against ...
The present disclosure relates to a control device for a food processing apparatus, and to a food processing apparatus, the apparatus comprising a food processing compartment (3) for a food substance, a heating unit (15) arranged to apply a heating procedure to the food substance, a weight sensor (44) ...
This invention relates to method of processing a food object while the food object is being conveyed, comprising acquiring image data of the food object (101), cutting the food object into smaller food pieces (102), determining, based on the acquired image data, whether the food object contains undesired ...